General Information

  • ID:  hor001013
  • Uniprot ID:  P48757
  • Protein name:  Gastrin-71
  • Gene name:  GAST
  • Organism:  Mus musculus (Mouse)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  Abundantly expressed in the stomach and duodenum. Low levels in brain, ovary and pancreas.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQLGPQGPQHFIADLSKKQRPRMEEEEEAYGWMDF
  • Length:  71
  • Propeptide:  MPRLCVYMLVLVLALATFSEASWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQLGPQGPQHFIADLSKKQRPRMEEEEEAYGWMDFGRRSAEEDQ
  • Signal peptide:  MPRLCVYMLVLVLALATFSEA
  • Modification:  T66 Sulfotyrosine;T71 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Cckbr
  • Target Unid:  P56481
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P48757-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001013_AF2.pdbhor001013_ESM.pdb

Physical Information

Mass: 948675 Formula: C355H543N111O113S2
Absent amino acids: CV Common amino acids: QES
pI: 6.8 Basic residues: 13
Polar residues: 17 Hydrophobic residues: 15
Hydrophobicity: -144.51 Boman Index: -23166
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 38.59
Instability Index: 7227.32 Extinction Coefficient cystines: 12490
Absorbance 280nm: 178.43

Literature

  • PubMed ID:  10982770
  • Title:  Glycine-extended Gastrin Synergizes With Gastrin 17 to Stimulate Acid Secretion in Gastrin-Deficient Mice